PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000199422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 233aa    MW: 26244.6 Da    PI: 10.1063
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000199422genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP69.41.2e-21171227258
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58 
                     g+kdrhsk++T +g+Rd R+Rls+++a++++d q++LG+ ++sk ++WLl +   +
  MDP0000199422 171 FGGKDRHSKVCTIRGLRDWRMRLSVPTAIQLYDHQERLGLNQPSKVVDWLLDDDHNQ 227
                    689************************************************886665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136922.077173231IPR017887Transcription factor TCP subgroup
PfamPF036344.7E-20173231IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MHQIPPSATD GKGVAAGVKN LEPRSKFMSP SSSELGSELL SPSSSEASSF PHRPSRCRSP  60
DWKHLNPCLP PSTHGSFVVR DRKKTEEVGE KYYQLAKNPT TIGYWKLENG LPEDGEEHQK  120
YSGGRLWSLT TSRECVAREA NKISSNPNLS RSLTPWPRLK DPRIVRASRA FGGKDRHSKV  180
CTIRGLRDWR MRLSVPTAIQ LYDHQERLGL NQPSKVVDWL LDDDHNQVRL LPG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163241e-108fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010672e-37KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348175.12e-88PREDICTED: transcription factor TCP13-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.12e-35plastid transcription factor 1